| Name | TC2N antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3749 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TC2N antibody was raised using the middle region of TC2N corresponding to a region with amino acids SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | TC2N Blocking Peptide |
| Description | Rabbit polyclonal TC2N antibody raised against the middle region of TC2N |
| Gene | TC2N |
| Supplier Page | Shop |