| Name | GALNTL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6899 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | GALNTL1 antibody was raised using the N terminal Of Galntl1 corresponding to a region with amino acids LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | GALNTL1 Blocking Peptide |
| Description | Rabbit polyclonal GALNTL1 antibody raised against the N terminal Of Galntl1 |
| Gene | GALNT16 |
| Supplier Page | Shop |