| Name | SLC41A2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1762 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SLC41A2 antibody was raised using the N terminal of SLC41A2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC41A2 Blocking Peptide |
| Description | Rabbit polyclonal SLC41A2 antibody raised against the N terminal of SLC41A2 |
| Gene | SLC41A2 |
| Supplier Page | Shop |