| Name | C20ORF160 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4133 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C20ORF160 antibody was raised using the N terminal Of C20Orf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C20ORF160 Blocking Peptide |
| Description | Rabbit polyclonal C20ORF160 antibody raised against the N terminal Of C20Orf160 |
| Gene | CCM2L |
| Supplier Page | Shop |