| Name | ATP2C1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5961 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ATP2C1 antibody was raised using the C terminal of ATP2C1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATP2C1 Blocking Peptide |
| Description | Rabbit polyclonal ATP2C1 antibody raised against the C terminal of ATP2C1 |
| Gene | PXDNL |
| Supplier Page | Shop |