PSMA5 antibody

Name PSMA5 antibody
Supplier Fitzgerald
Catalog 70R-4325
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, C. elegans, Drosophila
Antigen PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV
Purity/Format Affinity purified
Blocking Peptide PSMA5 Blocking Peptide
Description Rabbit polyclonal PSMA5 antibody
Gene PSMA5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.