| Name | MPV17L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3236 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MPV17L antibody was raised using the N terminal of MPV17L corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR |
| Purity/Format | Affinity purified |
| Blocking Peptide | MPV17L Blocking Peptide |
| Description | Rabbit polyclonal MPV17L antibody raised against the N terminal of MPV17L |
| Gene | MPV17L |
| Supplier Page | Shop |