| Name | ZNF19 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1055 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ZNF19 antibody was raised using the C terminal of ZNF19 corresponding to a region with amino acids HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ZNF19 Blocking Peptide |
| Description | Rabbit polyclonal ZNF19 antibody raised against the C terminal of ZNF19 |
| Gene | ZNF19 |
| Supplier Page | Shop |