| Name | Thymopoietin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6387 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP |
| Purity/Format | Affinity purified |
| Blocking Peptide | Thymopoietin Blocking Peptide |
| Description | Rabbit polyclonal Thymopoietin antibody raised against the N terminal of TMPO |
| Gene | TMPO |
| Supplier Page | Shop |