| Name | EPOr antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5994 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL |
| Purity/Format | Affinity purified |
| Blocking Peptide | EPOr Blocking Peptide |
| Description | Rabbit polyclonal EPOr antibody raised against the N terminal of EPOR |
| Gene | EPOR |
| Supplier Page | Shop |