Name | SEMA6D antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7125 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY |
Purity/Format | Affinity purified |
Blocking Peptide | SEMA6D Blocking Peptide |
Description | Rabbit polyclonal SEMA6D antibody raised against the N terminal of SEMA6D |
Gene | SEMA6D |
Supplier Page | Shop |