SEMA6D antibody

Name SEMA6D antibody
Supplier Fitzgerald
Catalog 70R-7125
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY
Purity/Format Affinity purified
Blocking Peptide SEMA6D Blocking Peptide
Description Rabbit polyclonal SEMA6D antibody raised against the N terminal of SEMA6D
Gene SEMA6D
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.