| Name | NUP43 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2178 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI |
| Purity/Format | Affinity purified |
| Blocking Peptide | NUP43 Blocking Peptide |
| Description | Rabbit polyclonal NUP43 antibody raised against the middle region of NUP43 |
| Gene | NUP43 |
| Supplier Page | Shop |