| Name | PIK3CB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1633 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PIK3CB antibody was raised using the C terminal of PIK3CB corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PIK3CB Blocking Peptide |
| Description | Rabbit polyclonal PIK3CB antibody raised against the C terminal of PIK3CB |
| Gene | PIK3CB |
| Supplier Page | Shop |