| Name | C6ORF64 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6964 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | C6ORF64 antibody was raised using the C terminal Of C6Orf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR |
| Purity/Format | Affinity purified |
| Blocking Peptide | C6ORF64 Blocking Peptide |
| Description | Rabbit polyclonal C6ORF64 antibody raised against the C terminal Of C6Orf64 |
| Gene | SAYSD1 |
| Supplier Page | Shop |