| Name | HRB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4741 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN |
| Purity/Format | Affinity purified |
| Blocking Peptide | HRB Blocking Peptide |
| Description | Rabbit polyclonal HRB antibody raised against the middle region of HRB |
| Gene | AGFG1 |
| Supplier Page | Shop |