Name | TGFBI antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1826 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | TGFBI Blocking Peptide |
Description | Rabbit polyclonal TGFBI antibody raised against the C terminal of TGFBI |
Gene | TGFBI |
Supplier Page | Shop |