| Name | PEX11A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6611 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PEX11A antibody was raised using the middle region of PEX11A corresponding to a region with amino acids MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PEX11A Blocking Peptide |
| Description | Rabbit polyclonal PEX11A antibody raised against the middle region of PEX11A |
| Gene | PEX11A |
| Supplier Page | Shop |