| Name | RNF111 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2018 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RNF111 antibody was raised using the C terminal of RNF111 corresponding to a region with amino acids TIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRRL |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF111 Blocking Peptide |
| Description | Rabbit polyclonal RNF111 antibody raised against the C terminal of RNF111 |
| Gene | RNF111 |
| Supplier Page | Shop |