Name | DNTT antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5671 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | DNTT antibody was raised using the middle region of DNTT corresponding to a region with amino acids LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN |
Purity/Format | Affinity purified |
Blocking Peptide | DNTT Blocking Peptide |
Description | Rabbit polyclonal DNTT antibody raised against the middle region of DNTT |
Gene | DNTT |
Supplier Page | Shop |