| Name | OR6C75 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6259 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | OR6C75 antibody was raised using the middle region of OR6C75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS |
| Purity/Format | Affinity purified |
| Blocking Peptide | OR6C75 Blocking Peptide |
| Description | Rabbit polyclonal OR6C75 antibody raised against the middle region of OR6C75 |
| Gene | OR6C75 |
| Supplier Page | Shop |