| Name | ZPLD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7542 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZPLD1 Blocking Peptide |
| Description | Rabbit polyclonal ZPLD1 antibody raised against the C terminal of ZPLD1 |
| Gene | ZPLD1 |
| Supplier Page | Shop |