| Name | PTPN2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6996 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PTPN2 antibody was raised using the middle region of PTPN2 corresponding to a region with amino acids ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN |
| Purity/Format | Affinity purified |
| Blocking Peptide | PTPN2 Blocking Peptide |
| Description | Rabbit polyclonal PTPN2 antibody raised against the middle region of PTPN2 |
| Gene | PTPN2 |
| Supplier Page | Shop |