C10ORF54 antibody

Name C10ORF54 antibody
Supplier Fitzgerald
Catalog 70R-6451
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C10ORF54 antibody was raised using the N terminal Of C10Orf54 corresponding to a region with amino acids TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
Purity/Format Affinity purified
Blocking Peptide C10ORF54 Blocking Peptide
Description Rabbit polyclonal C10ORF54 antibody raised against the N terminal Of C10Orf54
Gene C10orf54
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.