| Name | NOC4L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4965 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | NOC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | NOC4L Blocking Peptide |
| Description | Rabbit polyclonal NOC4L antibody |
| Gene | NOC4L |
| Supplier Page | Shop |