PNMA3 antibody

Name PNMA3 antibody
Supplier Fitzgerald
Catalog 70R-2050
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM
Purity/Format Affinity purified
Blocking Peptide PNMA3 Blocking Peptide
Description Rabbit polyclonal PNMA3 antibody raised against the N terminal of PNMA3
Gene PNMA3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.