DPP6 antibody

Name DPP6 antibody
Supplier Fitzgerald
Catalog 70R-6835
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT
Purity/Format Affinity purified
Blocking Peptide DPP6 Blocking Peptide
Description Rabbit polyclonal DPP6 antibody raised against the middle region of DPP6
Gene DPP6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.