| Name | CYTB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7028 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL |
| Purity/Format | Affinity purified |
| Blocking Peptide | CYTB Blocking Peptide |
| Description | Rabbit polyclonal CYTB antibody raised against the N terminal of CYTB |
| Gene | CYTB |
| Supplier Page | Shop |