| Name | FAM98B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4261 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM98B antibody was raised using the N terminal of FAM98B corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM98B Blocking Peptide |
| Description | Rabbit polyclonal FAM98B antibody raised against the N terminal of FAM98B |
| Gene | FAM98B |
| Supplier Page | Shop |