UCRC antibody

Name UCRC antibody
Supplier Fitzgerald
Catalog 70R-7221
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Purity/Format Affinity purified
Blocking Peptide UCRC Blocking Peptide
Description Rabbit polyclonal UCRC antibody
Gene UQCR10
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.