| Name | Cyclin M4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6323 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cyclin M4 Blocking Peptide |
| Description | Rabbit polyclonal Cyclin M4 antibody raised against the middle region of CNNM4 |
| Gene | CNNM4 |
| Supplier Page | Shop |