ITGB1BP2 antibody

Name ITGB1BP2 antibody
Supplier Fitzgerald
Catalog 70R-1183
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat
Antigen ITGB1BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF
Purity/Format Total IgG Protein A purified
Blocking Peptide ITGB1BP2 Blocking Peptide
Description Rabbit polyclonal ITGB1BP2 antibody
Gene ITGB1BP2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.