| Name | FAM113A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4106 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | FAM113A antibody was raised using the N terminal of FAM113A corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM113A Blocking Peptide |
| Description | Rabbit polyclonal FAM113A antibody raised against the N terminal of FAM113A |
| Gene | PCED1A |
| Supplier Page | Shop |