| Name | SARDH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1188 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SARDH Blocking Peptide |
| Description | Rabbit polyclonal SARDH antibody raised against the middle region of SARDH |
| Gene | SARDH |
| Supplier Page | Shop |