| Name | ABCG5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6712 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH |
| Purity/Format | Affinity purified |
| Blocking Peptide | ABCG5 Blocking Peptide |
| Description | Rabbit polyclonal ABCG5 antibody |
| Gene | ABCG5 |
| Supplier Page | Shop |