KLRF1 antibody

Name KLRF1 antibody
Supplier Fitzgerald
Catalog 70R-5966
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK
Purity/Format Affinity purified
Blocking Peptide KLRF1 Blocking Peptide
Description Rabbit polyclonal KLRF1 antibody raised against the middle region of KLRF1
Gene KLRF1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.