| Name | ATP1B1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6360 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ATP1B1 antibody was raised using the middle region of ATP1B1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATP1B1 Blocking Peptide |
| Description | Rabbit polyclonal ATP1B1 antibody raised against the middle region of ATP1B1 |
| Gene | ATP1B1 |
| Supplier Page | Shop |