Name | GDAP1L1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6552 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | GDAP1L1 antibody was raised using the N terminal of GDAP1L1 corresponding to a region with amino acids ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT |
Purity/Format | Affinity purified |
Blocking Peptide | GDAP1L1 Blocking Peptide |
Description | Rabbit polyclonal GDAP1L1 antibody raised against the N terminal of GDAP1L1 |
Gene | GDAP1L1 |
Supplier Page | Shop |