RTDR1 antibody

Name RTDR1 antibody
Supplier Fitzgerald
Catalog 70R-3433
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RTDR1 antibody was raised using the N terminal of RTDR1 corresponding to a region with amino acids MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL
Purity/Format Affinity purified
Blocking Peptide RTDR1 Blocking Peptide
Description Rabbit polyclonal RTDR1 antibody raised against the N terminal of RTDR1
Gene RSPH14
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.