CYP46A1 antibody

Name CYP46A1 antibody
Supplier Fitzgerald
Catalog 70R-7130
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CYP46A1 antibody was raised using the C terminal of CYP46A1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM
Purity/Format Affinity purified
Blocking Peptide CYP46A1 Blocking Peptide
Description Rabbit polyclonal CYP46A1 antibody raised against the C terminal of CYP46A1
Gene CYP46A1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.