| Name | FSTL5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1991 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD |
| Purity/Format | Affinity purified |
| Blocking Peptide | FSTL5 Blocking Peptide |
| Description | Rabbit polyclonal FSTL5 antibody raised against the middle region of FSTL5 |
| Gene | FSTL5 |
| Supplier Page | Shop |