| Name | FAM109A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4010 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM109A antibody was raised using the N terminal of FAM109A corresponding to a region with amino acids HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM109A Blocking Peptide |
| Description | Rabbit polyclonal FAM109A antibody raised against the N terminal of FAM109A |
| Gene | FAM109A |
| Supplier Page | Shop |