| Name | SSX2IP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6039 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SSX2IP antibody was raised using the middle region of SSX2IP corresponding to a region with amino acids KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA |
| Purity/Format | Affinity purified |
| Blocking Peptide | SSX2IP Blocking Peptide |
| Description | Rabbit polyclonal SSX2IP antibody raised against the middle region of SSX2IP |
| Gene | SSX2IP |
| Supplier Page | Shop |