| Name | RAP1GAP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2183 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RAP1GAP antibody was raised using the middle region of RAP1GAP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAP1GAP Blocking Peptide |
| Description | Rabbit polyclonal RAP1GAP antibody raised against the middle region of RAP1GAP |
| Gene | RAP1GAP |
| Supplier Page | Shop |