| Name | FAM118A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4554 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM118A antibody was raised using the middle region of FAM118A corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM118A Blocking Peptide |
| Description | Rabbit polyclonal FAM118A antibody raised against the middle region of FAM118A |
| Gene | FAM118A |
| Supplier Page | Shop |