| Name | XRRA1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4042 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | XRRA1 antibody was raised using the N terminal of XRRA1 corresponding to a region with amino acids MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG |
| Purity/Format | Affinity purified |
| Blocking Peptide | XRRA1 Blocking Peptide |
| Description | Rabbit polyclonal XRRA1 antibody raised against the N terminal of XRRA1 |
| Gene | XRRA1 |
| Supplier Page | Shop |