Sideroflexin 4 antibody

• Supplier: Fitzgerald
• Catalog: 70R-7001
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV
• Purity/Format: Affinity purified
• Blocking Peptide: Sideroflexin 4 Blocking Peptide
• Description: Rabbit polyclonal Sideroflexin 4 antibody raised against the C terminal of SFXN4
• Gene: SFXN4