| Name | PCCB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5324 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PCCB antibody was raised using the middle region of PCCB corresponding to a region with amino acids PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCCB Blocking Peptide |
| Description | Rabbit polyclonal PCCB antibody raised against the middle region of PCCB |
| Gene | PCCB |
| Supplier Page | Shop |