| Name | MRPS12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2407 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK |
| Purity/Format | Affinity purified |
| Blocking Peptide | MRPS12 Blocking Peptide |
| Description | Rabbit polyclonal MRPS12 antibody raised against the N terminal of MRPS12 |
| Gene | MRPS12 |
| Supplier Page | Shop |