| Name | DKFZP564O0523 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4970 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DKFZP564O0523 antibody was raised using the C terminal of DKFZP564O0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK |
| Purity/Format | Affinity purified |
| Blocking Peptide | DKFZP564O0523 Blocking Peptide |
| Description | Rabbit polyclonal DKFZP564O0523 antibody raised against the C terminal of DKFZP564O0523 |
| Gene | RBM48 |
| Supplier Page | Shop |