| Name | FANCA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3337 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FANCA Blocking Peptide |
| Description | Rabbit polyclonal FANCA antibody raised against the N terminal of FANCA |
| Gene | FANCA |
| Supplier Page | Shop |